1.67 Rating by CuteStat

newagework.com is 2 decades 5 years old. It is a domain having com extension. It has a global traffic rank of #12592961 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, newagework.com is SAFE to browse.

PageSpeed Score
92
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 38
Daily Pageviews: 76

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 1

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 12,592,961
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

97.74.144.127

Hosted Country:

United States of America US

Location Latitude:

33.6119

Location Longitude:

-111.8906
Site off-line | Drupal

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 97.74.144.127)

Creekside of Brentwood - Index

- creeksideofbrentwood.org

Creekside of Brentwood - Index

548,824 $ 1,200.00

راه کارگر نیوز

- rahekaregarnews.com

rahekaregar, راه کارگر,culture, rahekargar, iran, , politics, politic, left, socialism, ایران , news, persian, politics, news, revolution, reform, country, Teheran, Tabriz, Karaj, mashahd, abadan, kurdistan, kurdestan, rasht, ardebil, sanandaj, baneh, rahe karegar

1,387,314 $ 480.00

My Website | Just another WordPress site

- poolcleaningservicerepairmckinney.com
Not Applicable $ 8.95

Pool Cleaning and Repair Frisco Texas | Pool Cleaning Service and Repa

- poolcleaningservicerepairfrisco.com
Not Applicable $ 8.95

F.C. Playa Vista

- fcplayavista.com

FC Playa Vista is a recrational soccer club located in Marina Del Rey, California near Playa Vista. We have just begun expanding the club and will build several teams to play throughout Los Angeles.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 503 Service Unavailable
Date: Thu, 26 Jun 2014 00:48:19 GMT
Server: Apache
Cache-Control: max-age=1
Expires: Thu, 26 Jun 2014 00:48:20 GMT
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html

Domain Information

Domain Registrar: Network Solutions, LLC
Registration Date: Aug 1, 1998, 12:00 AM 2 decades 5 years 9 months ago
Last Modified: Jul 1, 2013, 12:00 AM 1 decade 10 months 1 week ago
Expiration Date: Jul 31, 2018, 12:00 AM 5 years 9 months 1 week ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns11.worldnic.com 162.159.26.214 United States of America United States of America
ns12.worldnic.com 162.159.27.150 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
newagework.com A 7197 IP: 97.74.144.127
newagework.com NS 7199 Target: ns12.worldnic.com
newagework.com NS 7199 Target: ns11.worldnic.com
newagework.com SOA 7199 MNAME: NS11.WORLDNIC.com
RNAME: namehost.WORLDNIC.com
Serial: 109052620
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum TTL: 3600
newagework.com MX 7199 Target: smtp.secureserver.net
newagework.com MX 7199 Priority: 10
Target: mailstore1.secureserver.net

Similarly Ranked Websites

403 Forbidden

- renardvert.org
12,592,962 $ 8.95

403 Forbidden

- nipplestoys.com
12,593,078 $ 8.95

carleescosmiccandies

- carleescosmiccandiesshop.com
12,593,120 $ 8.95

indobarianbdg.com coming soon!

- indobarianbdg.com
12,593,130 $ 8.95

Campistas en Red

- campistasenred.es

campistasenred.com - Red social campistas y camping en España: crea tu perfil y contacta con otros campistas, consulta la guía de campings, encuentra ofertas, bungalows, opiniones, foros, fotos, vídeos, actividades, chat, anuncios de caravanas y autocaravanas, crea grupos,

12,593,138 $ 8.95

Full WHOIS Lookup

Welcome to the Network Solutions(R) Registrar WHOIS Server.

The IP address from which you have visited the Network Solutions Registrar WHOIS
database is contained within a list of IP addresses that may have failed
to abide by Network Solutions' WHOIS policy. Failure to abide by this policy can
adversely impact our systems and servers, preventing the processing of
other WHOIS requests.

To see the Network Solutions WHOIS Policy, click on or copy and paste the following
URL into your browser:

http://www.networksolutions.com/whois/index.jhtml

If you feel that you have received this message in error, please email us using the online
form at http://www.networksolutions.com/help/email.jsp with the following information:

Whois Query: newagework.com
YOUR IP address is 162.216.5.200
Date and Time of Query: Wed Jun 25 20:48:21 EDT 2014
Reason Code: IE